Description
Product Overview
IGF-1 LR3 is a synthetic protein and lengthened analogue of human IGF-1. It retains the pharmacological activity of IGF-1 but has significantly higher biological potency.
Exceeds 99% purity, contains lyophilized powder.
WARNING: This product is a lyophilized peptide solely for research purposes. Not for human or animal consumption.
99%+ Purity Guaranteed
Third-party COA available
Shipped in temperature-controlled packaging
IGF-1 LR3 is a synthetic protein and lengthened analogue of human IGF-1. It retains the pharmacological activity of IGF-1 but has significantly higher biological potency.
| mg | 1mg |
|---|
| Molecular Formula | C400H625N111O115S9 |
| Molecular Mass | 9111.6 g/mol |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Purity | 99%+ (HPLC Verified) |